Recombinant Hepatitis C virus genotype 1b Genome polyprotein, partial

Artikelnummer: CSB-YP530838HVQ(A4)
Artikelname: Recombinant Hepatitis C virus genotype 1b Genome polyprotein, partial
Artikelnummer: CSB-YP530838HVQ(A4)
Hersteller Artikelnummer: CSB-YP530838HVQ(A4)
Alternativnummer: CSB-YP530838HVQ(A4)-1, CSB-YP530838HVQ(A4)-100, CSB-YP530838HVQ(A4)-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Genome polyprotein [Cleaved into: Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC
Molekulargewicht: 20.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: O92972
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 192-358aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: YEVRNVSGIYHVTNDCSNSSIVYEAADVIMHTPGCVPCVREGNSSRCWVALTPTLAARNASVPTTTIRRHVDLLVGTAAFCSAMYVGDLCGSIFLVSQLFTFSPRRHETVQDCNCSIYPGHVSGHRMAWDMMMNWSPTTALVVSQLLRIPQAVVDMVAGAHWGVLAG