Recombinant Hepatitis C virus genotype 1b Genome polyprotein, partial

Catalog Number: CSB-YP530838HVQ(A4)
Article Name: Recombinant Hepatitis C virus genotype 1b Genome polyprotein, partial
Biozol Catalog Number: CSB-YP530838HVQ(A4)
Supplier Catalog Number: CSB-YP530838HVQ(A4)
Alternative Catalog Number: CSB-YP530838HVQ(A4)-1, CSB-YP530838HVQ(A4)-100, CSB-YP530838HVQ(A4)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Genome polyprotein [Cleaved into: Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC 3.6.1.15, EC 3.6.4.13, Hepacivirin, NS3P, p70), Non-structural protein 4A, NS4A, p8), Non-structural protein 4B, NS4B, p27), Non-structural protein 5A, NS5A, p56), RNA-directed RNA polymerase, EC 2.7.7.48, NS5B, p68)]
Molecular Weight: 20.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: O92972
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 192-358aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YEVRNVSGIYHVTNDCSNSSIVYEAADVIMHTPGCVPCVREGNSSRCWVALTPTLAARNASVPTTTIRRHVDLLVGTAAFCSAMYVGDLCGSIFLVSQLFTFSPRRHETVQDCNCSIYPGHVSGHRMAWDMMMNWSPTTALVVSQLLRIPQAVVDMVAGAHWGVLAG
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.