Recombinant Human Calcium-binding protein p22 (CHP1)

Artikelnummer: CSB-YP860773HU
Artikelname: Recombinant Human Calcium-binding protein p22 (CHP1)
Artikelnummer: CSB-YP860773HU
Hersteller Artikelnummer: CSB-YP860773HU
Alternativnummer: CSB-YP860773HU-1, CSB-YP860773HU-100, CSB-YP860773HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Calcineurin B-like protein,Calcium-binding protein CHP,Calcium-binding protein p22,EF-hand calcium-binding domain-containing protein p22
Molekulargewicht: 23.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q99653
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 2-195aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Anwendungsbeschreibung: Research Areas: Others