Recombinant Human Calcium-binding protein p22 (CHP1)

Catalog Number: CSB-YP860773HU
Article Name: Recombinant Human Calcium-binding protein p22 (CHP1)
Biozol Catalog Number: CSB-YP860773HU
Supplier Catalog Number: CSB-YP860773HU
Alternative Catalog Number: CSB-YP860773HU-1, CSB-YP860773HU-100, CSB-YP860773HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Calcineurin B-like protein,Calcium-binding protein CHP,Calcium-binding protein p22,EF-hand calcium-binding domain-containing protein p22
Molecular Weight: 23.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q99653
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 2-195aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Application Notes: Research Areas: Others