ACTH (7-38) human / Corticotropin Inhibiting Peptide (7-38) human, CAS [[68563-24-6]]

Produktübersicht

• Artikelname: ACTH (7-38) human / Corticotropin Inhibiting Peptide (7-38) human, CAS [[68563-24-6]]
• Artikelnummer: ECH-111-45-5MG
• Hersteller Artikelnummer: 111-45-5mg
• Alternativnummer: ECH-111-45-5MG
• Hersteller: Echelon Biosciences
• Kategorie: Molekularbiologie

Produktbeschreibung

CAS Number: 68563-24-6Molecular Weight: 3656.92Salt Form: TFAPurity: >96%Sequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OHSequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OHStorage: -20 AC or belowACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors.

Produkteigenschaften

• Tag: 1178
• CAS Nummer: [68563-24-6]