ACTH (7-38) human / Corticotropin Inhibiting Peptide (7-38) human, CAS [[68563-24-6]]

Product Overview

• Article Name: ACTH (7-38) human / Corticotropin Inhibiting Peptide (7-38) human, CAS [[68563-24-6]]
• Biozol Catalog Number: ECH-111-45-5MG
• Supplier Catalog Number: 111-45-5mg
• Alternative Catalog Number: ECH-111-45-5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 68563-24-6Molecular Weight: 3656.92Salt Form: TFAPurity: >96%Sequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OHSequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OHStorage: -20 AC or belowACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors.

Product Properties

• Tag: 1178
• CAS Number: [68563-24-6]