Calcitonin Gene Related Peptide II (CGRP II human) cyclic, CAS [[98824-26-1]]

Produktübersicht

• Artikelname: Calcitonin Gene Related Peptide II (CGRP II human) cyclic, CAS [[98824-26-1]]
• Artikelnummer: ECH-231-29-0.5MG
• Hersteller Artikelnummer: 231-29-0.5mg
• Alternativnummer: ECH-231-29-0.5MG
• Hersteller: Echelon Biosciences
• Kategorie: Molekularbiologie

Produktbeschreibung

CAS Number: 98824-26-1Molecular Weight: 3792.94Salt Form: TFAPurity: >95%Sequence (3-letter): Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 [Cys2-Cys7]Sequence (1-letter): ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2Storage: -20 AC or belowCalcitonin Gene Related Peptide II (CGRP II) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system appetite suppression gastric acid release temperature homeostasis and heart rate. CGRP exists in two forms CGRP I (CGRPalpha,) and CGRP II (CGRPbeta,)

Produkteigenschaften

• Tag: 1185
• CAS Nummer: [98824-26-1]