Calcitonin Gene Related Peptide II (CGRP II human) cyclic, CAS [[98824-26-1]]

Product Overview

• Article Name: Calcitonin Gene Related Peptide II (CGRP II human) cyclic, CAS [[98824-26-1]]
• Biozol Catalog Number: ECH-231-29-0.5MG
• Supplier Catalog Number: 231-29-0.5mg
• Alternative Catalog Number: ECH-231-29-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 98824-26-1Molecular Weight: 3792.94Salt Form: TFAPurity: >95%Sequence (3-letter): Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 [Cys2-Cys7]Sequence (1-letter): ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2Storage: -20 AC or belowCalcitonin Gene Related Peptide II (CGRP II) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system appetite suppression gastric acid release temperature homeostasis and heart rate. CGRP exists in two forms CGRP I (CGRPalpha,) and CGRP II (CGRPbeta,)

Product Properties

• Tag: 1185
• CAS Number: [98824-26-1]