Parathyroid Hormone (PTH) (1-34) human, CAS [[52232-67-4]]

Artikelnummer: ECH-231-40-0.5MG
Artikelname: Parathyroid Hormone (PTH) (1-34) human, CAS [[52232-67-4]]
Artikelnummer: ECH-231-40-0.5MG
Hersteller Artikelnummer: 231-40-0.5mg
Alternativnummer: ECH-231-40-0.5MG
Hersteller: Echelon Biosciences
Kategorie: Molekularbiologie
CAS Number: 52232-67-4Molecular Weight: 4115.16Salt Form: TFAPurity: >96%Sequence (3-letter): Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OHSequence (1-letter): SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OHStorage: -20 AC or belowParathyroid Hormone (PTH) (1-34) is a bioactive fragment of the full length Parathyroid Hormone. PTH regulates serum calcium levels through its effects in the kidney intestines and bones. When serum calcium levels are low PTH is secreted by the chief cells of the parathyroid gland stimulating osteoclast activity and bone resorption thus the release of calcium.
Tag: 1178
CAS Nummer: [52232-67-4]