Parathyroid Hormone (PTH) (1-34) human, CAS [[52232-67-4]]

Product Overview

• Article Name: Parathyroid Hormone (PTH) (1-34) human, CAS [[52232-67-4]]
• Biozol Catalog Number: ECH-231-40-0.5MG
• Supplier Catalog Number: 231-40-0.5mg
• Alternative Catalog Number: ECH-231-40-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 52232-67-4Molecular Weight: 4115.16Salt Form: TFAPurity: >96%Sequence (3-letter): Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OHSequence (1-letter): SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OHStorage: -20 AC or belowParathyroid Hormone (PTH) (1-34) is a bioactive fragment of the full length Parathyroid Hormone. PTH regulates serum calcium levels through its effects in the kidney intestines and bones. When serum calcium levels are low PTH is secreted by the chief cells of the parathyroid gland stimulating osteoclast activity and bone resorption thus the release of calcium.

Product Properties

• Tag: 1178
• CAS Number: [52232-67-4]