PACAP (1-27) ovine human, CAS [[127317-03-7]]

Produktübersicht

• Artikelname: PACAP (1-27) ovine human, CAS [[127317-03-7]]
• Artikelnummer: ECH-350-37-0.5MG
• Hersteller Artikelnummer: 350-37-0.5mg
• Alternativnummer: ECH-350-37-0.5MG
• Hersteller: Echelon Biosciences
• Kategorie: Molekularbiologie

Produktbeschreibung

CAS Number: 127317-03-7Molecular Weight: 3145.66Salt Form: TFAPurity: >95%Sequence (3-letter): His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2Sequence (1-letter): HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Storage: -20 AC or belowPituitary adenylate cyclase-activating polypeptide (PACAP) stimulates adenylate cyclase and increases cAMP levels in cells. It is primarily expressed in nervous tissues and has high homology to vasoactive intestinal peptide (VIP). PACAP exists as 38- or 27-amino acid forms though the 1-38 form is predominant. PACAP binds to PAC1-R VPAC1-R and VPAC2-R receptors. PACAP functions as a neurotransmitter and neuromodulator.

Produkteigenschaften

• Tag: 1178
• CAS Nummer: [127317-03-7]