PACAP (1-27) ovine human, CAS [[127317-03-7]]

Catalog Number: ECH-350-37-0.5MG
Article Name: PACAP (1-27) ovine human, CAS [[127317-03-7]]
Biozol Catalog Number: ECH-350-37-0.5MG
Supplier Catalog Number: 350-37-0.5mg
Alternative Catalog Number: ECH-350-37-0.5MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 127317-03-7Molecular Weight: 3145.66Salt Form: TFAPurity: >95%Sequence (3-letter): His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2Sequence (1-letter): HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2Storage: -20 AC or belowPituitary adenylate cyclase-activating polypeptide (PACAP) stimulates adenylate cyclase and increases cAMP levels in cells. It is primarily expressed in nervous tissues and has high homology to vasoactive intestinal peptide (VIP). PACAP exists as 38- or 27-amino acid forms though the 1-38 form is predominant. PACAP binds to PAC1-R VPAC1-R and VPAC2-R receptors. PACAP functions as a neurotransmitter and neuromodulator.
Tag: 1178
CAS Number: [127317-03-7]