Pancreatic Polypeptide avian

Produktübersicht

• Artikelname: Pancreatic Polypeptide avian
• Artikelnummer: ECH-478-40-1MG
• Hersteller Artikelnummer: 478-40-1mg
• Alternativnummer: ECH-478-40-1MG
• Hersteller: Echelon Biosciences
• Kategorie: Molekularbiologie

Produktbeschreibung

Molecular Weight: 4235.09Salt Form: TFAPurity: >95%Sequence (3-letter): Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asp-Ala-Pro-Val-Glu-Asp-Leu-Ile-Arg-Phe-Tyr-Asp-Asn-Leu-Gln-Gln-Tyr-Leu-Asn-Val-Val-Thr-Arg-His-Arg-Tyr-NH2Sequence (1-letter): GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2Storage: -20 AC or belowPancreatic Polypeptide (PP) is an agonist at neuropeptide Y receptors. It is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas that affects the secretion of pancreatic enzymes water and electrolytes. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal.