Pancreatic Polypeptide avian

Catalog Number: ECH-478-40-1MG
Article Name: Pancreatic Polypeptide avian
Biozol Catalog Number: ECH-478-40-1MG
Supplier Catalog Number: 478-40-1mg
Alternative Catalog Number: ECH-478-40-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
Molecular Weight: 4235.09Salt Form: TFAPurity: >95%Sequence (3-letter): Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asp-Ala-Pro-Val-Glu-Asp-Leu-Ile-Arg-Phe-Tyr-Asp-Asn-Leu-Gln-Gln-Tyr-Leu-Asn-Val-Val-Thr-Arg-His-Arg-Tyr-NH2Sequence (1-letter): GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2Storage: -20 AC or belowPancreatic Polypeptide (PP) is an agonist at neuropeptide Y receptors. It is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas that affects the secretion of pancreatic enzymes water and electrolytes. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal.