Cecropin B, CAS [[80451-05-4]]

Produktübersicht

• Artikelname: Cecropin B, CAS [[80451-05-4]]
• Artikelnummer: ECH-893-50-1MG
• Hersteller Artikelnummer: 893-50-1mg
• Alternativnummer: ECH-893-50-1MG
• Hersteller: Echelon Biosciences
• Kategorie: Molekularbiologie

Produktbeschreibung

CAS Number: 80451-05-4Molecular Weight: 3832.29Salt Form: TFAPurity: >96%Sequence (3-letter): Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2Sequence (1-letter): KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2Storage: -20 AC or belowCecropin B is a cationic antimicrobial peptide isolated from the hemolyph of Hyalophora cecropia (cecropia moth). Cecropins are part of the insect innate immunity system and act against primarily Gram-negative bacteria.

Produkteigenschaften

• Tag: 1206
• CAS Nummer: [80451-05-4]