Cecropin B, CAS [[80451-05-4]]

Catalog Number: ECH-893-50-1MG
Article Name: Cecropin B, CAS [[80451-05-4]]
Biozol Catalog Number: ECH-893-50-1MG
Supplier Catalog Number: 893-50-1mg
Alternative Catalog Number: ECH-893-50-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 80451-05-4Molecular Weight: 3832.29Salt Form: TFAPurity: >96%Sequence (3-letter): Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2Sequence (1-letter): KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2Storage: -20 AC or belowCecropin B is a cationic antimicrobial peptide isolated from the hemolyph of Hyalophora cecropia (cecropia moth). Cecropins are part of the insect innate immunity system and act against primarily Gram-negative bacteria.
Tag: 1206
CAS Number: [80451-05-4]