HtrA1 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: HtrA1 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX00643
• Hersteller Artikelnummer: GTX00643
• Alternativnummer: GTX00643-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD).
• Konjugation: Unconjugated
• Alternative Synonym: ARMD7 , CADASIL2 , CARASIL , HTRA1 , HtrA , HtrA serine peptidase 1 , L56 , ORF480 , PRSS11 , HtrA1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 51
• NCBI: 5654
• UniProt: Q92743
• Puffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide.
• Formulierung: Liquid

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.