HtrA1 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: HtrA1 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX00643
• Supplier Catalog Number: GTX00643
• Alternative Catalog Number: GTX00643-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD).
• Conjugation: Unconjugated
• Alternative Names: ARMD7 , CADASIL2 , CARASIL , HTRA1 , HtrA , HtrA serine peptidase 1 , L56 , ORF480 , PRSS11 , HtrA1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 51
• NCBI: 5654
• UniProt: Q92743
• Buffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide.
• Form: Liquid

Application Notes

• Application Notes: WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.