Mineralocorticoid Receptor antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: GTX00779
Artikelname: Mineralocorticoid Receptor antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: GTX00779
Hersteller Artikelnummer: GTX00779
Alternativnummer: GTX00779-100
Hersteller: GeneTex
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: This antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Konjugation: Unconjugated
Alternative Synonym: nuclear receptor subfamily 3 group C member 2 , MCR , MLR , MR , NR3C2VIT
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Molekulargewicht: 107
Sensitivitaet: Superfamily members of NR3C2 are not reactive to this antibody.
NCBI: 4306
UniProt: P08235
Puffer: 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide.
Formulierung: Liquid
Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.