| Article Name: |
Mineralocorticoid Receptor antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
GTX00779 |
| Supplier Catalog Number: |
GTX00779 |
| Alternative Catalog Number: |
GTX00779-100 |
| Manufacturer: |
GeneTex |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
This antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. |
| Conjugation: |
Unconjugated |
| Alternative Names: |
nuclear receptor subfamily 3 group C member 2 , MCR , MLR , MR , NR3C2VIT |
