MEFV antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: MEFV antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX01088
• Hersteller Artikelnummer: GTX01088
• Alternativnummer: GTX01088-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR).
• Konjugation: Unconjugated
• Alternative Synonym: MEFV innate immuity regulator, pyrin , FMF , MEF , MEFV , Mediterranean fever , TRIM20

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 86
• NCBI: 4210
• UniProt: O15553
• Puffer: 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide.
• Formulierung: Liquid

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.