MEFV antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: GTX01088
Artikelname: MEFV antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: GTX01088
Hersteller Artikelnummer: GTX01088
Alternativnummer: GTX01088-100
Hersteller: GeneTex
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR).
Konjugation: Unconjugated
Alternative Synonym: MEFV innate immuity regulator, pyrin , FMF , MEF , MEFV , Mediterranean fever , TRIM20
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Molekulargewicht: 86
NCBI: 4210
UniProt: O15553
Puffer: 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide.
Formulierung: Liquid
Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.