MEFV antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: MEFV antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX01088
• Supplier Catalog Number: GTX01088
• Alternative Catalog Number: GTX01088-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR).
• Conjugation: Unconjugated
• Alternative Names: MEFV innate immuity regulator, pyrin , FMF , MEF , MEFV , Mediterranean fever , TRIM20

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 86
• NCBI: 4210
• UniProt: O15553
• Buffer: 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide.
• Form: Liquid

Application Notes

• Application Notes: WB: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.