Interferon gamma Receptor 1 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Interferon gamma Receptor 1 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX02780
• Hersteller Artikelnummer: GTX02780
• Alternativnummer: GTX02780-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC, ICC, IHC-Fr, WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: interferon gamma receptor 1 , CD119 , IFNGR , IMD27A , IMD27B

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 54
• NCBI: 3459
• UniProt: P15260
• Puffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide.
• Formulierung: Liquid

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. ICC/IF: 0.5-1µg/ml. IHC-Fr: 0.5-1µg/ml. FCM: 1-3µg/1x106 cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.