Interferon gamma Receptor 1 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Interferon gamma Receptor 1 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX02780
• Supplier Catalog Number: GTX02780
• Alternative Catalog Number: GTX02780-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: FC, ICC, IHC-Fr, WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
• Conjugation: Unconjugated
• Alternative Names: interferon gamma receptor 1 , CD119 , IFNGR , IMD27A , IMD27B

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 54
• NCBI: 3459
• UniProt: P15260
• Buffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Sodium azide.
• Form: Liquid

Application Notes

• Application Notes: WB: 0.1-0.5µg/ml. ICC/IF: 0.5-1µg/ml. IHC-Fr: 0.5-1µg/ml. FCM: 1-3µg/1x106 cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.