Lysozyme antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: GTX03467
Artikelname: Lysozyme antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: GTX03467
Hersteller Artikelnummer: GTX03467
Alternativnummer: GTX03467-100
Hersteller: GeneTex
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa, NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
Konjugation: Unconjugated
Alternative Synonym: lysozyme , LYZF1 , LZM
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Molekulargewicht: 17
NCBI: 4069
UniProt: P61626
Puffer: 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
Formulierung: Liquid
Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. ICC/IF: 5µg/ml. IHC-P: 0.5-1µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.