Lysozyme antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Lysozyme antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX03467
• Supplier Catalog Number: GTX03467
• Alternative Catalog Number: GTX03467-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa, NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
• Conjugation: Unconjugated
• Alternative Names: lysozyme , LYZF1 , LZM

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 17
• NCBI: 4069
• UniProt: P61626
• Buffer: 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
• Form: Liquid

Application Notes

• Application Notes: WB: 0.1-0.5µg/ml. ICC/IF: 5µg/ml. IHC-P: 0.5-1µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.