MMP11 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: MMP11 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX03717
• Hersteller Artikelnummer: GTX03717
• Alternativnummer: GTX03717-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: matrix metallopeptidase 11 , SL-3 , ST3 , STMY3

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 55
• NCBI: 4320
• UniProt: P24347
• Puffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
• Formulierung: Liquid

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.