MMP11 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: MMP11 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX03717
• Supplier Catalog Number: GTX03717
• Alternative Catalog Number: GTX03717-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
• Conjugation: Unconjugated
• Alternative Names: matrix metallopeptidase 11 , SL-3 , ST3 , STMY3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 55
• NCBI: 4320
• UniProt: P24347
• Buffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
• Form: Liquid

Application Notes

• Application Notes: WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.