AHR antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: GTX03719
Artikelname: AHR antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: GTX03719
Hersteller Artikelnummer: GTX03719
Alternativnummer: GTX03719-100
Hersteller: GeneTex
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC, ICC, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH).
Konjugation: Unconjugated
Alternative Synonym: aryl hydrocarbon receptor , bHLHe76
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Molekulargewicht: 96
NCBI: 196
UniProt: P35869
Puffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
Formulierung: Liquid
Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. ICC/IF: 0.5-1µg/ml. IHC-P: 0.5-1µg/ml. FCM: 1-3µg/1x106 cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.