AHR antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: AHR antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX03719
• Hersteller Artikelnummer: GTX03719
• Alternativnummer: GTX03719-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC, ICC, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH).
• Konjugation: Unconjugated
• Alternative Synonym: aryl hydrocarbon receptor , bHLHe76

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 96
• NCBI: 196
• UniProt: P35869
• Puffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
• Formulierung: Liquid

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. ICC/IF: 0.5-1µg/ml. IHC-P: 0.5-1µg/ml. FCM: 1-3µg/1x106 cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.