AHR antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
GTX03719
- Images (0)
| Article Name: | AHR antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | GTX03719 |
| Supplier Catalog Number: | GTX03719 |
| Alternative Catalog Number: | GTX03719-100 |
| Manufacturer: | GeneTex |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | FC, ICC, IHC-P, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH). |
| Conjugation: | Unconjugated |
| Alternative Names: | aryl hydrocarbon receptor , bHLHe76 |
| Application Notes: | WB: 0.1-0.5µg/ml. ICC/IF: 0.5-1µg/ml. IHC-P: 0.5-1µg/ml. FCM: 1-3µg/1x106 cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications. |
