AHR antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: GTX03719
Article Name: AHR antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: GTX03719
Supplier Catalog Number: GTX03719
Alternative Catalog Number: GTX03719-100
Manufacturer: GeneTex
Host: Rabbit
Category: Antikörper
Application: FC, ICC, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH).
Conjugation: Unconjugated
Alternative Names: aryl hydrocarbon receptor , bHLHe76
Clonality: Polyclonal
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Molecular Weight: 96
NCBI: 196
UniProt: P35869
Buffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
Form: Liquid
Application Notes: WB: 0.1-0.5µg/ml. ICC/IF: 0.5-1µg/ml. IHC-P: 0.5-1µg/ml. FCM: 1-3µg/1x106 cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.