TMEM166 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: TMEM166 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX04091
• Hersteller Artikelnummer: GTX04091
• Alternativnummer: GTX04091-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC, ICC, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).
• Konjugation: Unconjugated
• Alternative Synonym: eva-1 homolog A, regulator of programmed cell death , FAM176A , TMEM166

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: .5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 17
• NCBI: 84141
• UniProt: Q9H8M9
• Puffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
• Formulierung: Liquid