TMEM166 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: TMEM166 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX04091
• Supplier Catalog Number: GTX04091
• Alternative Catalog Number: GTX04091-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: FC, ICC, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).
• Conjugation: Unconjugated
• Alternative Names: eva-1 homolog A, regulator of programmed cell death , FAM176A , TMEM166

Product Properties

• Clonality: Polyclonal
• Concentration: .5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 17
• NCBI: 84141
• UniProt: Q9H8M9
• Buffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
• Form: Liquid