METTL4 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
GTX04574
- Bilder (0)
| Artikelname: | METTL4 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | GTX04574 |
| Hersteller Artikelnummer: | GTX04574 |
| Alternativnummer: | GTX04574-100 |
| Hersteller: | GeneTex |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human Mettl4: SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS . |
| Konjugation: | Unconjugated |
| Alternative Synonym: | methyltransferase like 4 , HsT661 |
