METTL4 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: METTL4 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX04574
• Hersteller Artikelnummer: GTX04574
• Alternativnummer: GTX04574-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Mettl4: SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS .
• Konjugation: Unconjugated
• Alternative Synonym: methyltransferase like 4 , HsT661

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 54
• NCBI: 64863
• UniProt: Q8N3J2
• Puffer: PBS, 2% sucrose, 0.09% Sodium Azide.
• Formulierung: Liquid