METTL4 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: METTL4 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX04574
• Supplier Catalog Number: GTX04574
• Alternative Catalog Number: GTX04574-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Mettl4: SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS .
• Conjugation: Unconjugated
• Alternative Names: methyltransferase like 4 , HsT661

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 54
• NCBI: 64863
• UniProt: Q8N3J2
• Buffer: PBS, 2% sucrose, 0.09% Sodium Azide.
• Form: Liquid