TMEM26 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: TMEM26 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX04582
• Hersteller Artikelnummer: GTX04582
• Alternativnummer: GTX04582-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide directed towards the C-terminal region of Human TMEM26 (RSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVTSDDSH)
• Konjugation: Unconjugated
• Alternative Synonym: transmembrane protein 26

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 42
• NCBI: 219623
• UniProt: Q6ZUK4
• Puffer: PBS, 2% sucrose, 0.09% sodium azide.
• Formulierung: Liquid