TMEM26 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: TMEM26 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX04582
• Supplier Catalog Number: GTX04582
• Alternative Catalog Number: GTX04582-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide directed towards the C-terminal region of Human TMEM26 (RSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVTSDDSH)
• Conjugation: Unconjugated
• Alternative Names: transmembrane protein 26

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 42
• NCBI: 219623
• UniProt: Q6ZUK4
• Buffer: PBS, 2% sucrose, 0.09% sodium azide.
• Form: Liquid