TMEM26 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
GTX04582
- Images (0)
| Article Name: | TMEM26 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | GTX04582 |
| Supplier Catalog Number: | GTX04582 |
| Alternative Catalog Number: | GTX04582-100 |
| Manufacturer: | GeneTex |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | A synthetic peptide directed towards the C-terminal region of Human TMEM26 (RSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVTSDDSH) |
| Conjugation: | Unconjugated |
| Alternative Names: | transmembrane protein 26 |
