CHMP4C antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: CHMP4C antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX04627
• Hersteller Artikelnummer: GTX04627
• Alternativnummer: GTX04627-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Mouse
• Immunogen: A synthetic peptide directed towards the C-terminal region of Mouse Chmp4c: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA
• Konjugation: Unconjugated
• Alternative Synonym: charged multivesicular body protein 4C , 2010012P02Rik , 2210015K02Rik , 2310010I16Rik , Shax3 , Snf7-3

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 26
• NCBI: 66371
• UniProt: Q9D7F7
• Puffer: PBS, 2% sucrose, 0.09% sodium azide.
• Formulierung: Liquid