CHMP4C antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: CHMP4C antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX04627
• Supplier Catalog Number: GTX04627
• Alternative Catalog Number: GTX04627-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Mouse
• Immunogen: A synthetic peptide directed towards the C-terminal region of Mouse Chmp4c: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA
• Conjugation: Unconjugated
• Alternative Names: charged multivesicular body protein 4C , 2010012P02Rik , 2210015K02Rik , 2310010I16Rik , Shax3 , Snf7-3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 26
• NCBI: 66371
• UniProt: Q9D7F7
• Buffer: PBS, 2% sucrose, 0.09% sodium azide.
• Form: Liquid