Transcobalamin 2 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Transcobalamin 2 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX04825
• Hersteller Artikelnummer: GTX04825
• Alternativnummer: GTX04825-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Mouse
• Immunogen: A synthetic peptide corresponding to a region of Mouse: PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS
• Konjugation: Unconjugated

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 48
• NCBI: 21452
• UniProt: O88968
• Puffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Formulierung: Liquid