Transcobalamin 2 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Transcobalamin 2 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX04825
• Supplier Catalog Number: GTX04825
• Alternative Catalog Number: GTX04825-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Mouse
• Immunogen: A synthetic peptide corresponding to a region of Mouse: PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 48
• NCBI: 21452
• UniProt: O88968
• Buffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Form: Liquid