LRRC15 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: LRRC15 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX04827
• Hersteller Artikelnummer: GTX04827
• Alternativnummer: GTX04827-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide directed towards the N terminal region of human LRRC15: LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG
• Konjugation: Unconjugated
• Alternative Synonym: LIB,LRRC15,leucine rich repeat containing 15

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 64
• NCBI: 131578
• UniProt: Q8TF66
• Puffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Formulierung: Liquid