LRRC15 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
GTX04827
- Images (0)
| Article Name: | LRRC15 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | GTX04827 |
| Supplier Catalog Number: | GTX04827 |
| Alternative Catalog Number: | GTX04827-100 |
| Manufacturer: | GeneTex |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | A synthetic peptide directed towards the N terminal region of human LRRC15: LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG |
| Conjugation: | Unconjugated |
| Alternative Names: | LIB,LRRC15,leucine rich repeat containing 15 |
