LRRC15 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: LRRC15 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX04827
• Supplier Catalog Number: GTX04827
• Alternative Catalog Number: GTX04827-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide directed towards the N terminal region of human LRRC15: LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG
• Conjugation: Unconjugated
• Alternative Names: LIB,LRRC15,leucine rich repeat containing 15

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 64
• NCBI: 131578
• UniProt: Q8TF66
• Buffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Form: Liquid