ZXDA antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: GTX04842
Artikelname: ZXDA antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: GTX04842
Hersteller Artikelnummer: GTX04842
Alternativnummer: GTX04842-100
Hersteller: GeneTex
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide directed towards the middle region of human ZXDA, within the following region: PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV.
Konjugation: Unconjugated
Alternative Synonym: ZNF896,ZXDA,zinc finger, Xlinked, duplicated A,zinc finger X-linked duplicated A
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Molekulargewicht: 85
NCBI: 7789
UniProt: P98168
Puffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
Formulierung: Liquid