ZXDA antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: ZXDA antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX04842
• Hersteller Artikelnummer: GTX04842
• Alternativnummer: GTX04842-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide directed towards the middle region of human ZXDA, within the following region: PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV.
• Konjugation: Unconjugated
• Alternative Synonym: ZNF896,ZXDA,zinc finger, Xlinked, duplicated A,zinc finger X-linked duplicated A

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 85
• NCBI: 7789
• UniProt: P98168
• Puffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Formulierung: Liquid