ZXDA antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: ZXDA antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX04842
• Supplier Catalog Number: GTX04842
• Alternative Catalog Number: GTX04842-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide directed towards the middle region of human ZXDA, within the following region: PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV.
• Conjugation: Unconjugated
• Alternative Names: ZNF896,ZXDA,zinc finger, Xlinked, duplicated A,zinc finger X-linked duplicated A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 85
• NCBI: 7789
• UniProt: P98168
• Buffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Form: Liquid