PARP11 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: PARP11 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX04915
• Hersteller Artikelnummer: GTX04915
• Alternativnummer: GTX04915-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide directed towards the middle region of human PARP11 : IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD
• Konjugation: Unconjugated
• Alternative Synonym: ARTD11,C12orf6,MIB006,PARP11,poly(ADPribose) polymerase family member 11,poly(ADP-ribose) polymerase family member 11

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 39
• NCBI: 57097
• UniProt: Q9NR21
• Puffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Formulierung: Liquid

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB: 0.2-1 µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.