PARP11 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: PARP11 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX04915
• Supplier Catalog Number: GTX04915
• Alternative Catalog Number: GTX04915-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide directed towards the middle region of human PARP11 : IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD
• Conjugation: Unconjugated
• Alternative Names: ARTD11,C12orf6,MIB006,PARP11,poly(ADPribose) polymerase family member 11,poly(ADP-ribose) polymerase family member 11

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 39
• NCBI: 57097
• UniProt: Q9NR21
• Buffer: PBS, 2% Sucrose, 0.09% Sodium Azide.
• Form: Liquid

Application Notes

• Application Notes: WB: 0.2-1 µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.