GATSL3 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: GATSL3 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX04957
• Hersteller Artikelnummer: GTX04957
• Alternativnummer: GTX04957-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide directed towards the C-terminal region of Human GATSL3 protein: EPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGG
• Konjugation: Unconjugated
• Alternative Synonym: CASTOR1,GATS protein like 3,GATSL3,cytosolic arginine sensor for mTORC1 subunit 1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 36
• NCBI: 652968
• UniProt: Q8WTX7
• Puffer: PBS, 2% sucrose, 0.09% Sodium Azide.
• Formulierung: Liquid