GATSL3 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: GATSL3 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX04957
• Supplier Catalog Number: GTX04957
• Alternative Catalog Number: GTX04957-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide directed towards the C-terminal region of Human GATSL3 protein: EPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGG
• Conjugation: Unconjugated
• Alternative Names: CASTOR1,GATS protein like 3,GATSL3,cytosolic arginine sensor for mTORC1 subunit 1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 36
• NCBI: 652968
• UniProt: Q8WTX7
• Buffer: PBS, 2% sucrose, 0.09% Sodium Azide.
• Form: Liquid