NHE3 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: NHE3 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX04975
• Hersteller Artikelnummer: GTX04975
• Alternativnummer: GTX04975-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide directed towards the middle region of human SLC9A3: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
• Konjugation: Unconjugated
• Alternative Synonym: DIAR8,NHE3,SLC9A3,solute carrier family 9 member A3,Hydrogen Exchanger 3

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 93
• NCBI: 6550
• UniProt: P48764
• Puffer: PBS, 2 % Sucrose, 0.09% Sodium Azide.
• Formulierung: Liquid