NHE3 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: NHE3 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX04975
• Supplier Catalog Number: GTX04975
• Alternative Catalog Number: GTX04975-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide directed towards the middle region of human SLC9A3: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
• Conjugation: Unconjugated
• Alternative Names: DIAR8,NHE3,SLC9A3,solute carrier family 9 member A3,Hydrogen Exchanger 3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 93
• NCBI: 6550
• UniProt: P48764
• Buffer: PBS, 2 % Sucrose, 0.09% Sodium Azide.
• Form: Liquid